PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006319
Common NameLOC102601659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 26208.7 Da    PI: 9.4532
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006319genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.91e-26959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+ien++nrqvt+skRrngi+KKA+EL vLCda++++i++sst k +ey s
  PGSC0003DMP400006319  9 KKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTS 59
                          68***********************************************75 PP

2K-box82.78.4e-2871168198
                 K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                           yq++ g++ +++++e++q++l++L++ +++L+re+R++ Ged++ L+l+eL +L++++ +s+ +iR++K++++++q+++ +kk ++l+e
  PGSC0003DMP400006319  71 YQSALGVDIWSTHYEKMQENLKRLQEINNKLRREIRQRTGEDMSGLNLQELCHLQENITESVAEIRERKYHVIKNQTDTCRKKVRNLEE 159
                           67888999********************************************************************************* PP

                 K-box  90 enkaLrkkl 98 
                           ++ +L   l
  PGSC0003DMP400006319 160 QHGNLVLDL 168
                           **9997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SMARTSM004326.5E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.06E-35295IPR002100Transcription factor, MADS-box
CDDcd002653.69E-37280No hitNo description
PRINTSPR004048.0E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-263859IPR002100Transcription factor, MADS-box
PfamPF014869.7E-2082165IPR002487Transcription factor, K-box
PROSITE profilePS5129714.6684174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGRGKIEIKK IENSTNRQVT YSKRRNGIFK KAKELTVLCD AKISLIMLSS TRKYHEYTSP  60
NTTTKKMIDQ YQSALGVDIW STHYEKMQEN LKRLQEINNK LRREIRQRTG EDMSGLNLQE  120
LCHLQENITE SVAEIRERKY HVIKNQTDTC RKKVRNLEEQ HGNLVLDLEA KCEDPKYGVV  180
ENEGHYNSAV AFANGVHNLY AFRLQPLHPN LQNEEGFGSR DLRLS*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755164e-66HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340689.11e-168PREDICTED: floral homeotic protein DEFICIENS-like
SwissprotP237062e-94DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLM0ZVL61e-168M0ZVL6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000091121e-168(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23142451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.17e-73MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]